PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10655_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 200aa    MW: 22713.3 Da    PI: 7.5949
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10655_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.3e-10750344
                                          SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
                       Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                                           WT+ Ed+ + +a  +++ +   +W +Ia+ ++ g+t+++++ ++
  cra_locus_10655_iso_3_len_1140_ver_3  7 TWTKFEDKMFEQALVMYPDDvpdRWQKIAKSLP-GKTPEDVRVHY 50
                                          7*****************99*************.*********99 PP

2Myb_DNA-binding41.43.3e-13106150347
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           +WT+eE+ l++ +  ++G+g+W++I+r    +Rt+ q+ s+ qky
  cra_locus_10655_iso_3_len_1140_ver_3 106 PWTEEEHRLFLIGLSRYGKGDWRSISRNCVVTRTPTQVASHAQKY 150
                                           8***************************999*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.486158IPR017930Myb domain
SMARTSM007172.0E-9456IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-6754IPR009057Homeodomain-like
PfamPF002495.4E-9751IPR001005SANT/Myb domain
CDDcd001673.21E-9754No hitNo description
SuperFamilySSF466891.94E-12762IPR009057Homeodomain-like
PROSITE profilePS5129419.05199155IPR017930Myb domain
SuperFamilySSF466898.97E-17101155IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-16102154IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.6E-11103149IPR009057Homeodomain-like
SMARTSM007175.5E-9103153IPR001005SANT/Myb domain
PfamPF002495.7E-11106150IPR001005SANT/Myb domain
CDDcd001671.06E-9106150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MSDSGVTWTK FEDKMFEQAL VMYPDDVPDR WQKIAKSLPG KTPEDVRVHY EALVHDVLEI  60
DSGRVELPSY IDDDSCGWDS DSKSNQISFG SSGKAKHDVE RKKGTPWTEE EHRLFLIGLS  120
RYGKGDWRSI SRNCVVTRTP TQVASHAQKY YLRQSAVKKE RKRSSIHDIT TAVECKTVPP  180
PRNFGPDGGG YQDFNFPGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-18470773RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796939.11e-101PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016510488.11e-101PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068TV401e-101A0A068TV40_COFCA; Uncharacterized protein
STRINGSolyc11g006720.1.11e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241